Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNOT7 Peptide - C-terminal region

CNOT7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CAF1, Caf1a, hCAF-1

UniProt

Q9UIV1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037486.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERINC2 (NM_018565) Human Over-expression Lysate
LC434248 20 µg

SERINC2 (NM_018565) Human Over-expression Lysate

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2776), CF568 conjugate, 0.1mg/mL
BNC682776-500 1x 500 µL

CD80 (B7-1) (C80/2776), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS636096 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF640R conjugate, 0.1mg/mL
BNC403540-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (PECAM1/3540), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p57 Kip2 (CDKN1C) Human Gene Knockout Kit (CRISPR)
KN209840LP 1 Kit

p57 Kip2 (CDKN1C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HEAB (CLP1) Rabbit Monoclonal Antibody
TA424319 100 µL

HEAB (CLP1) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details