Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX10 Peptide - middle region

SNX10 Peptide - middle region

Product Specifications

Product Name Alternative

OPTB8

UniProt

Q9Y5X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001186764.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFALMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr668 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
33347064 1.0 µg DNA

Olfr668 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
DNASE1 siRNA (Mouse)
MBS8215493-01 15 nmol

DNASE1 siRNA (Mouse)

Sign In for Pricing
View Details
DNASE1 siRNA (Mouse)
MBS8215493-02 30 nmol

DNASE1 siRNA (Mouse)

Sign In for Pricing
View Details
DNASE1 siRNA (Mouse)
MBS8215493-03 5x 30 nmol

DNASE1 siRNA (Mouse)

Sign In for Pricing
View Details
MST1R (macrophage Stimulating 1 Receptor (c-met-Related Tyrosine Kinase), CD136, CDw136, PTK8, RON) (Biotin)
248969-Biotin 100 µL

MST1R (macrophage Stimulating 1 Receptor (c-met-Related Tyrosine Kinase), CD136, CDw136, PTK8, RON) (Biotin)

Sign In for Pricing
View Details
Goat Pyridinoline ELISA kit
GTR10434444 96 Well

Goat Pyridinoline ELISA kit

Sign In for Pricing
View Details