Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBIAD1 Peptide - N-terminal region

UBIAD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCCD, TERE1

UniProt

Q9Y5Z9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037451.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNRD1 Antibody
KC-29244-01 50 μL

TXNRD1 Antibody

Sign In for Pricing
View Details
TXNRD1 Antibody
KC-29244-02 100 µL

TXNRD1 Antibody

Sign In for Pricing
View Details
TXNRD1 Antibody
KC-29244-03 1 mL

TXNRD1 Antibody

Sign In for Pricing
View Details
Adrenergic Receptor α-2A Antibody
8C10309-AAT 50 µg

Adrenergic Receptor α-2A Antibody

Sign In for Pricing
View Details
FBXL4 Polyclonal Antibody
E-AB-19857-01 20 µL

FBXL4 Polyclonal Antibody

Sign In for Pricing
View Details
FBXL4 Polyclonal Antibody
E-AB-19857-02 60 µL

FBXL4 Polyclonal Antibody

Sign In for Pricing
View Details