Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBIAD1 Peptide - N-terminal region

UBIAD1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCCD, TERE1

UniProt

Q9Y5Z9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037451.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RING finger protein unkempt like (UNKL) activation kit by CRISPRa
GA112111 1 Kit

Human RING finger protein unkempt like (UNKL) activation kit by CRISPRa

Sign In for Pricing
View Details
SHP2 (PTPN11) Human Gene Knockout Kit (CRISPR)
KN220029LP 1 Kit

SHP2 (PTPN11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,4-Dinitrophenol(wetted with water >15%)
TRC-D480753-50MG 50 mg

3,4-Dinitrophenol(wetted with water >15%)

Sign In for Pricing
View Details
2-Hydroxychrysene
TRC-H905340-1MG 1 mg

2-Hydroxychrysene

Sign In for Pricing
View Details
S100A1 (Melanoma Marker) (S100A1/1942), CF640R conjugate, 0.1mg/mL
BNC401942-500 1x 500 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STEAP3 Human Gene Knockout Kit (CRISPR)
KN210595LP 1 Kit

STEAP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details