Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC61A1 Peptide - middle region

SEC61A1 Peptide - middle region

Product Specifications

Product Name Alternative

SEC61, HSEC61, SEC61A

UniProt

P61619

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_037468.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Shadow Effect Tube, Electromagnet
1130140 1 Each

Shadow Effect Tube, Electromagnet

Sign In for Pricing
View Details
VDAC1P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV789235 1.0 µg DNA

VDAC1P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
SMARCC1 Rabbit Monoclonal Antibody [Clone ID: R07-6K6]
TA385285 100 µL

SMARCC1 Rabbit Monoclonal Antibody [Clone ID: R07-6K6]

Sign In for Pricing
View Details
Lipolysis Stimulated Lipoprotein Receptor (FITC)
548480 200 µL

Lipolysis Stimulated Lipoprotein Receptor (FITC)

Sign In for Pricing
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (FITC)
MBS6338263-01 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (FITC)

Sign In for Pricing
View Details
PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (FITC)
MBS6338263-02 5x 0.2 mL

PSMD14, CT (PSMD14, POH1, 26S proteasome non-ATPase regulatory subunit 14, 26S proteasome regulatory subunit RPN11, 26S proteasome-associated PAD1 homolog 1) (FITC)

Sign In for Pricing
View Details