Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCAF8 Peptide - middle region

DCAF8 Peptide - middle region

Product Specifications

Product Name Alternative

GAN2, H326, WDR42A

UniProt

Q5TAQ9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_056541.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVQRKRANRDQDSSDDERALEDWVSSETSALPRPRWQALPALRERELGSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-EpCAM [KS1/4]
orb1089960 0.2 mg

Anti-EpCAM [KS1/4]

Sign In for Pricing
View Details
NLRX1 Knockout AGS Polyclonal Cells
ARG2432 1 Million

NLRX1 Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Mouse CD70 Protein, hFc Tag
orb1826788-01 10 µg

Mouse CD70 Protein, hFc Tag

Sign In for Pricing
View Details
Mouse CD70 Protein, hFc Tag
orb1826788-02 50 µg

Mouse CD70 Protein, hFc Tag

Sign In for Pricing
View Details
Mouse CD70 Protein, hFc Tag
orb1826788-03 100 µg

Mouse CD70 Protein, hFc Tag

Sign In for Pricing
View Details
4'-C-Fluoroadenosine 2',3',5'-Tribenzoate
433921-01 10 mg

4'-C-Fluoroadenosine 2',3',5'-Tribenzoate

Sign In for Pricing
View Details