Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1H Peptide - C-terminal region

PPM1H Peptide - C-terminal region

Product Specifications

Product Name Alternative

URCC2, ARHCL1, NERPP-2C

UniProt

Q9ULR3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHRYTLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Enhancer Of Zeste Homolog 1 (EZH1) Antibody
abx176279-01 200 µg

Enhancer Of Zeste Homolog 1 (EZH1) Antibody

Sign In for Pricing
View Details
Enhancer Of Zeste Homolog 1 (EZH1) Antibody
abx176279-02 1 mg

Enhancer Of Zeste Homolog 1 (EZH1) Antibody

Sign In for Pricing
View Details
RAC1 Rabbit Polyclonal Antibody (Biotin)
orb2093332 100 µL

RAC1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GRM8 Antibody
MBS2529394-01 0.06 mL

GRM8 Antibody

Sign In for Pricing
View Details
GRM8 Antibody
MBS2529394-02 0.12 mL

GRM8 Antibody

Sign In for Pricing
View Details
GRM8 Antibody
MBS2529394-03 0.2 mL

GRM8 Antibody

Sign In for Pricing
View Details