Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1H Peptide - C-terminal region

PPM1H Peptide - C-terminal region

Product Specifications

Product Name Alternative

URCC2, ARHCL1, NERPP-2C

UniProt

Q9ULR3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065751.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PHRYTLAAQDLVMRARGVLKDRGWRISNDRLGSGDDISVYVIPLIHGNKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-01 0.02 mg (E-Coli)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-02 0.02 mg (Yeast)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-03 0.1 mg (E-Coli)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-04 0.1 mg (Yeast)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)
MBS1244431-06 0.02 mg (Mammalian-Cell)

Recombinant Pseudomonas aeruginosa B-type flagellin (fliC)

Sign In for Pricing
View Details