Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR48 Peptide - C-terminal region

WDR48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P80, UAF1, SPG60

UniProt

Q8TAF3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001290331.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor III (TGFBR3) Rabbit Polyclonal Antibody
TA361136 100 µL

TGF beta Receptor III (TGFBR3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse FBXL12 siRNA
abx916550-01 15 nmol

Mouse FBXL12 siRNA

Sign In for Pricing
View Details
Mouse FBXL12 siRNA
abx916550-02 30 nmol

Mouse FBXL12 siRNA

Sign In for Pricing
View Details
ExbD Antibody
orb814197 2 mg

ExbD Antibody

Sign In for Pricing
View Details
ALX3 Polyclonal Antibody
JOT-AP00394-01 20 µL

ALX3 Polyclonal Antibody

Sign In for Pricing
View Details
ALX3 Polyclonal Antibody
JOT-AP00394-02 50 μL

ALX3 Polyclonal Antibody

Sign In for Pricing
View Details