What is the catalog number for WDR48 Peptide - C-terminal region?

The catalog number for WDR48 Peptide - C-terminal region is orb2001361.

What sizes are available for WDR48 Peptide - C-terminal region?

WDR48 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is WDR48 Peptide - C-terminal region in stock?

WDR48 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

WDR48 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P80, UAF1, SPG60

UniProt

Q8TAF3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001290331.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKDRLSASDMLQVRKVMEHVYEKIINLDNESQTTSSSNNEKPGEQEKEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV315640 500 ng

Vom1r90 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing

View Details

CS603583 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing

View Details

OR1043144-01 100 mg

Tert-Butyl 3-amino-3- (hydroxymethyl) pyrrolidine-1-carboxylate

Sign In for Pricing

View Details

OR1043144-02 250 mg

Tert-Butyl 3-amino-3- (hydroxymethyl) pyrrolidine-1-carboxylate

Sign In for Pricing

View Details

OR1043144-03 1 g

Tert-Butyl 3-amino-3- (hydroxymethyl) pyrrolidine-1-carboxylate

Sign In for Pricing

View Details

OR1043144-04 5 g

Tert-Butyl 3-amino-3- (hydroxymethyl) pyrrolidine-1-carboxylate

Sign In for Pricing

View Details