What is the catalog number for HAMP Peptide - middle region?

The catalog number for HAMP Peptide - middle region is orb2001356.

What sizes are available for HAMP Peptide - middle region?

HAMP Peptide - middle region is available in the following size(s): 100 µg.

Is HAMP Peptide - middle region in stock?

HAMP Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HAMP Peptide - middle region

Product Specifications

Product Name Alternative

HEPC, PLTR, HFE2B, LEAP1

UniProt

P81172

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066998.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR110897 1 g

5-Bromo-2- (1,3-oxazol-5-yl) pyridine

Sign In for Pricing

View Details

GTR10426691 96 Well

Sheep ARF GTPase activating protein GIT2 (GIT2) ELISA kit

Sign In for Pricing

View Details

RC213098 10 µg

TMEM16A (ANO1) (NM_018043) Human Tagged ORF Clone

Sign In for Pricing

View Details

K6765707 1.0 µg DNA

Prdx2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing

View Details

orb1174697 100 µg

TMEM156 Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

orb2066016 100 µL

CREB5 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details