Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAMP Peptide - middle region

HAMP Peptide - middle region

Product Specifications

Product Name Alternative

HEPC, PLTR, HFE2B, LEAP1

UniProt

P81172

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_066998.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: WAACLLLLLLLASLTSGSVFPQQTGQLAELQPQDRAGARASWMPMFQRRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin-A1 (EFNA1) Rat ELISA Kit
D2052 96 Tests

Ephrin-A1 (EFNA1) Rat ELISA Kit

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2142611-01 0.1 mL

FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2142611-02 0.2 mL

FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2142611-03 0.5 mL

FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2142611-04 1 mL

FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)
MBS2142611-05 5 mL

FITC-Linked Monoclonal Antibody to Complement Component 1, S Subcomponent (C1s)

Sign In for Pricing
View Details