Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP27 Peptide - middle region

MMP27 Peptide - middle region

Product Specifications

Product Name Alternative

MMP-27

UniProt

Q9H306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_071405.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Fxyd1 shRNA (UAS) - Lentiviral mouse Fxyd1 shRNA (UAS) plasmid
GTR15245527 1 Vial

Lentiviral mouse Fxyd1 shRNA (UAS) - Lentiviral mouse Fxyd1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human RFWD3 Protein Lysate 20ug
IHURFWD3PLLY20UG 20 µg

Human RFWD3 Protein Lysate 20ug

Sign In for Pricing
View Details
Rabbit Polyclonal CRYBB3 Antibody
NBP2-49196 0.1 mL

Rabbit Polyclonal CRYBB3 Antibody

Sign In for Pricing
View Details
CYP1A2-Specific Antibody
abx232148 100 µg

CYP1A2-Specific Antibody

Sign In for Pricing
View Details
Mis18a Mouse shRNA Lentiviral Particle (Locus ID 66578)
TL503664V 500 µL Each

Mis18a Mouse shRNA Lentiviral Particle (Locus ID 66578)

Sign In for Pricing
View Details
Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)
MBS6212788-01 0.1 mL

Nibrin (ATV, AT-V1, AT-V2, Cell Cycle Regulatory Protein p95, FLJ10155, MGC87362, NBN, Nijmegen Breakage Syndrome, NBS, Nijmegen Breakage Syndrome Protein 1, NBS1, p95 NBS1) (MaxLight 550)

Sign In for Pricing
View Details