Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP27 Peptide - middle region

MMP27 Peptide - middle region

Product Specifications

Product Name Alternative

MMP-27

UniProt

Q9H306

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_071405.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNLF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERICH5 Protein Lysate
OCOA05046-20UG 20 µg

ERICH5 Protein Lysate

Sign In for Pricing
View Details
PIK3AP1 Protein Vector (Human) (pPM-C-HA)
PV031331 500 ng

PIK3AP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human proteoglycan B (PGB) ELISA Kit
YP-W11930-01 48 Tests

Human proteoglycan B (PGB) ELISA Kit

Sign In for Pricing
View Details
Human proteoglycan B (PGB) ELISA Kit
YP-W11930-02 96 Tests

Human proteoglycan B (PGB) ELISA Kit

Sign In for Pricing
View Details
Palladium (II) acetate
M37974-01 200 mg

Palladium (II) acetate

Sign In for Pricing
View Details
Palladium (II) acetate
M37974-02 1 g

Palladium (II) acetate

Sign In for Pricing
View Details