LRRC19 Peptide - middle region
LRRC19 Peptide - middle region
Product Specifications
UniProt
Q9H756
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_075052.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2158487-01 96 Tests
Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2158487-02 5x 96 Tests
Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details MBS2158487-03 10x 96 Tests
Acyl Coenzyme A Oxidase 1, Palmitoyl (ACOX1) Magnetic Fluorescence Assay Kit
Sign In for Pricing
View Details 
MBS7269520-01 48 Well
Rat Eukaryotic peptide chain release factor GTP-binding subunit ERF3A, GSPT1 ELISA Kit
Sign In for Pricing
View Details MBS7269520-02 96 Well
Rat Eukaryotic peptide chain release factor GTP-binding subunit ERF3A, GSPT1 ELISA Kit
Sign In for Pricing
View Details