Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC19 Peptide - middle region

LRRC19 Peptide - middle region

Product Specifications

UniProt

Q9H756

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_075052.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSVTEDLYIHFQPISNSIFNSSSNNLTRNSEHEPLGKSWAFLVGVVVTV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPE Antibody
GWB-MU484G 50 µg

RPE Antibody

Sign In for Pricing
View Details
CD31 (PECAM1) Rabbit Polyclonal Antibody
TA384958 100 µL

CD31 (PECAM1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Samd5 shRNA (UAS) - Lentiviral mouse Samd5 shRNA (UAS, RFP) (25)
GTR15259415 1 Vial

Lentiviral mouse Samd5 shRNA (UAS) - Lentiviral mouse Samd5 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Polink-2 Plus HRP Rat with DAB 18ml Kit (No cross to mouse)
D46-18 Each

Polink-2 Plus HRP Rat with DAB 18ml Kit (No cross to mouse)

Sign In for Pricing
View Details
GATA6 Rabbit Polyclonal Antibody (Cy3)
orb2597984 100 µg

GATA6 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
NDUFA1 Rabbit pAb
A8326-01 100 μL

NDUFA1 Rabbit pAb

Sign In for Pricing
View Details