Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP4F12 Peptide - middle region

CYP4F12 Peptide - middle region

Product Specifications

Product Name Alternative

CYPIVF12, F22329_1

UniProt

Q9HCS2

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076433.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Cell division cycle associated protein 2 (CDCA2) ELISA Kit
GTR10340125 96 Well

Chicken Cell division cycle associated protein 2 (CDCA2) ELISA Kit

Sign In for Pricing
View Details
CLEC6A Peptide - N-terminal region (AAP44533)
AAP44533-100UG 100 µg

CLEC6A Peptide - N-terminal region (AAP44533)

Sign In for Pricing
View Details
Ttc9b Rat shRNA Plasmid (Locus ID 361528)
TR707014 1 Kit

Ttc9b Rat shRNA Plasmid (Locus ID 361528)

Sign In for Pricing
View Details
PLV3-CMV-CTCFL-3xMyc-CopGFP-Neo Plasmid
PVT80646 2 µg

PLV3-CMV-CTCFL-3xMyc-CopGFP-Neo Plasmid

Sign In for Pricing
View Details
Anti-beta-actin Mouse mAb
MBS4751579-01 0.1 mL

Anti-beta-actin Mouse mAb

Sign In for Pricing
View Details
Anti-beta-actin Mouse mAb
MBS4751579-02 5x 0.1 mL

Anti-beta-actin Mouse mAb

Sign In for Pricing
View Details