GDAP1L1 Peptide - middle region
GDAP1L1 Peptide - middle region
Product Specifications
Product Name Alternative
DJ881L22.1, dJ995J12.1.1
UniProt
Q96MZ0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_001243666.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OM619511 96 Strip Well
Bovine Activator of 90 kDa heat shock protein ATPase homolog 1 (AHSA1) ELISA Kit
Sign In for Pricing
View Details 132513-FITC 100 µL
RGCC (C13orf15, RGC32, Regulator of Cell Cycle RGCC, Response Gene to Complement 32 Protein) (FITC)
Sign In for Pricing
View Details 
orb2907661-01 20 µg
Recombinant Pseudomonas syringae pv. tomato Prolipoprotein diacylglyceryl transferase (lgt)
Sign In for Pricing
View Details orb2907661-02 100 µg
Recombinant Pseudomonas syringae pv. tomato Prolipoprotein diacylglyceryl transferase (lgt)
Sign In for Pricing
View Details