Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDAP1L1 Peptide - middle region

GDAP1L1 Peptide - middle region

Product Specifications

Product Name Alternative

DJ881L22.1, dJ995J12.1.1

UniProt

Q96MZ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001243666.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
47744066 1.0 µg DNA

TRIM11 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Anti-EXTL3 Polyclonal Antibody
PAV1354 100 μL

Rabbit Anti-EXTL3 Polyclonal Antibody

Sign In for Pricing
View Details
CREB2 Polyclonal Antibody
RD77327A-01 20 µL

CREB2 Polyclonal Antibody

Sign In for Pricing
View Details
CREB2 Polyclonal Antibody
RD77327A-02 60 μL

CREB2 Polyclonal Antibody

Sign In for Pricing
View Details
CREB2 Polyclonal Antibody
RD77327A-03 120 μL

CREB2 Polyclonal Antibody

Sign In for Pricing
View Details
CREB2 Polyclonal Antibody
RD77327A-04 200 µL

CREB2 Polyclonal Antibody

Sign In for Pricing
View Details