Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP37 Peptide - middle region

NUP37 Peptide - middle region

Product Specifications

Product Name Alternative

P37

UniProt

Q8NFH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076962.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SLC6A12 Antibody Picoband® FITC Conjugated
A07083-1-FITC 100 µg/Vial

Anti-SLC6A12 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL
BNC682265-500 1x 500 µL

BCL2-like 2 (CPTC-BCL2L2-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lamin A/C (A-5)
sc-398927 200 µg/mL

Lamin A/C (A-5)

Sign In for Pricing
View Details
Far upstream element-binding protein 3 Antibody (Fluoro594)
orb3165659 100 µg

Far upstream element-binding protein 3 Antibody (Fluoro594)

Sign In for Pricing
View Details
Recombinant Murine sAPRIL/TNFSF13
MEOPP-1903 5 µg

Recombinant Murine sAPRIL/TNFSF13

Sign In for Pricing
View Details
Mouse Monoclonal CD59 Antibody (MEM-43/5) [mFluor Violet 450 SE]
NB500-400MFV450 0.1 mL

Mouse Monoclonal CD59 Antibody (MEM-43/5) [mFluor Violet 450 SE]

Sign In for Pricing
View Details