Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP37 Peptide - middle region

NUP37 Peptide - middle region

Product Specifications

Product Name Alternative

P37

UniProt

Q8NFH4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076962.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNTFKVGAVAGNDWLIWDITRSSYPQNKRPVHMDRACLFRWSTISENLFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE-2
PR412-3ml 3 mL

ACE-2

Sign In for Pricing
View Details
RAX Protein Lysate
OCOA11337-20UG 20 µg

RAX Protein Lysate

Sign In for Pricing
View Details
Cryopreserved Bladder Epithelial Cells (HBlEpC), adult
938-05a 1 Cryovial

Cryopreserved Bladder Epithelial Cells (HBlEpC), adult

Sign In for Pricing
View Details
DYN3 Polyclonal Antibody
E44H09687 100 µL

DYN3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CTBP2 Protein, N-His
orb3061479-01 50 µg

Recombinant Human CTBP2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CTBP2 Protein, N-His
orb3061479-02 100 µg

Recombinant Human CTBP2 Protein, N-His

Sign In for Pricing
View Details