What is the catalog number for PRRG4 Peptide - middle region?

The catalog number for PRRG4 Peptide - middle region is orb2001346.

What sizes are available for PRRG4 Peptide - middle region?

PRRG4 Peptide - middle region is available in the following size(s): 100 µg.

Is PRRG4 Peptide - middle region in stock?

PRRG4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PRRG4 Peptide - middle region

Product Specifications

Product Name Alternative

TMG4, PRGP4

UniProt

Q9BZD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076986.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-547142 1 Kit

C-Myb (D-7) : m-IgG2a BP-HRP Bundle

Sign In for Pricing

View Details

31069061 1.0 µg DNA

MTND6P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

OKAG01042-96W 96 Well

OKAG01042-96W - Smad4 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing

View Details

19496091 4x 500 ng

ESPNL-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing

View Details

TA368197 100 µL

DOC2B Rabbit Polyclonal Antibody

Sign In for Pricing

View Details

orb827437 2 mg

RluE Antibody

Sign In for Pricing

View Details