What is the catalog number for PRRG4 Peptide - middle region?

The catalog number for PRRG4 Peptide - middle region is orb2001346.

What sizes are available for PRRG4 Peptide - middle region?

PRRG4 Peptide - middle region is available in the following size(s): 100 µg.

Is PRRG4 Peptide - middle region in stock?

PRRG4 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PRRG4 Peptide - middle region

Product Specifications

Product Name Alternative

TMG4, PRGP4

UniProt

Q9BZD6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076986.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IAFWQEYSAKGPTTKSDGNREKIDVMGLLTGLIAAGVFLVIFGLLGYYLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMM12828VCF 100 µg

POFUT2 Mouse Monoclonal Antibody [Clone ID: LBI3A12]

Sign In for Pricing

View Details

MBS2077782-01 0.1 mL

FITC-Linked Polyclonal Antibody to Nephroblastoma Overexpressed Gene (NOV)

Sign In for Pricing

View Details

MBS2077782-02 0.2 mL

FITC-Linked Polyclonal Antibody to Nephroblastoma Overexpressed Gene (NOV)

Sign In for Pricing

View Details

MBS2077782-03 0.5 mL

FITC-Linked Polyclonal Antibody to Nephroblastoma Overexpressed Gene (NOV)

Sign In for Pricing

View Details

MBS2077782-04 1 mL

FITC-Linked Polyclonal Antibody to Nephroblastoma Overexpressed Gene (NOV)

Sign In for Pricing

View Details

MBS2077782-05 5 mL

FITC-Linked Polyclonal Antibody to Nephroblastoma Overexpressed Gene (NOV)

Sign In for Pricing

View Details