Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KDELC1 Peptide - middle region

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R1B Polyclonal Antibody
E-AB-67477-01 60 µL

PPP1R1B Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R1B Polyclonal Antibody
E-AB-67477-02 120 µL

PPP1R1B Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R1B Polyclonal Antibody
E-AB-67477-03 200 µL

PPP1R1B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Carbohydrate Sulfotransferase 10/CHST10 Antibody
NBP2-84588-0.1mL 0.1 mL

Rabbit Polyclonal Carbohydrate Sulfotransferase 10/CHST10 Antibody

Sign In for Pricing
View Details
LDLRAD3 (NM_174902) Human Tagged Lenti ORF Clone
RC207286L4 10 µg

LDLRAD3 (NM_174902) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TKTL1 Double Nickase Plasmid (h)
sc-411134-NIC 20 µg

TKTL1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details