What is the catalog number for KDELC1 Peptide - middle region?

The catalog number for KDELC1 Peptide - middle region is orb2001345.

What sizes are available for KDELC1 Peptide - middle region?

KDELC1 Peptide - middle region is available in the following size(s): 100 µg.

Is KDELC1 Peptide - middle region in stock?

KDELC1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

KDELC1 Peptide - middle region

Product Specifications

Product Name Alternative

EP58, KDEL1

UniProt

Q6UW63

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_076994.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFVNLGDWPLEKKKSNSNIHPIFSWCGSTDSKDIVMPTYDLTDSVLETMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP2-74271CL1 0.1 mL

Mouse Monoclonal SOAT 2 Antibody (OTI2D3) [CoraFluor 1]

Sign In for Pricing

View Details

RR208160L4V 200 µL

Zfand2a (NM_001008363) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing

View Details

MBS2546398-01 0.1 mg

Recombinant Human LCN2 / NGAL Protein (His tag)

Sign In for Pricing

View Details

MBS2546398-02 5x 0.1 mg

Recombinant Human LCN2 / NGAL Protein (His tag)

Sign In for Pricing

View Details

A22338 500 µL

SARS-CoV-2 Nucleoprotein Rabbit mAb

Sign In for Pricing

View Details

10430066-01 1 g

Dibenzylphosphorochloridate 10% w/v solution in benzene

Sign In for Pricing

View Details