LOXL2 Peptide - middle region
LOXL2 Peptide - middle region
Product Specifications
Product Name Alternative
LOR2, WS9-14
UniProt
Q9Y4K0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_002309.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15100138 1 Vial
Lentiviral human DNAJC5B shRNA (UAS) - Lentiviral human DNAJC5B shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details E5114Hu-01 48 Well
Human Complement factor H-related protein 5, CFHR5 ELISA KIT
Sign In for Pricing
View Details E5114Hu-02 96 Well
Human Complement factor H-related protein 5, CFHR5 ELISA KIT
Sign In for Pricing
View Details E5114Hu-03 5x 96 Tests
Human Complement factor H-related protein 5, CFHR5 ELISA KIT
Sign In for Pricing
View Details E5114Hu-04 10x 96 Tests
Human Complement factor H-related protein 5, CFHR5 ELISA KIT
Sign In for Pricing
View Details