LOXL2 Peptide - middle region
LOXL2 Peptide - middle region
Product Specifications
Product Name Alternative
LOR2, WS9-14
UniProt
Q9Y4K0
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_002309.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-13893R-BF405 100 µL
CHD4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
Sign In for Pricing
View Details ab-131-117 500 µg
Rat monoclonal antibody to Mouse CD70 (Clone FR70)
Sign In for Pricing
View Details 
abx537330 96 Tests
Mouse OTU domain-containing protein 6B (OTUD6B) ELISA Kit
Sign In for Pricing
View Details 
PO54925M2 100 µg
SARS-CoV-2 (2019-nCoV) Spike RBD (F456L) -His Recombinant Protein
Sign In for Pricing
View Details