Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOVA2 Peptide - middle region

NOVA2 Peptide - middle region

Product Specifications

Product Name Alternative

ANOVA, NOVA3

UniProt

Q9UNW9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002507.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBP1 Polyclonal Antibody
E-AB-66026-01 60 µL

WBP1 Polyclonal Antibody

Sign In for Pricing
View Details
WBP1 Polyclonal Antibody
E-AB-66026-02 120 µL

WBP1 Polyclonal Antibody

Sign In for Pricing
View Details
WBP1 Polyclonal Antibody
E-AB-66026-03 200 µL

WBP1 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse TNFα protein (His tag)
PDMM100005-01 20 µg

Recombinant Mouse TNFα protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFα protein (His tag)
PDMM100005-02 100 µg

Recombinant Mouse TNFα protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFα protein (His tag)
PDMM100005-03 500 µg

Recombinant Mouse TNFα protein (His tag)

Sign In for Pricing
View Details