Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOVA2 Peptide - middle region

NOVA2 Peptide - middle region

Product Specifications

Product Name Alternative

ANOVA, NOVA3

UniProt

Q9UNW9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002507.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCS1L (NM_001079866) Human Over-expression Lysate
LC421566 20 µg

BCS1L (NM_001079866) Human Over-expression Lysate

Sign In for Pricing
View Details
SPON1 (N-term) Rabbit Polyclonal Antibody
AP54519PU-N 400 µL

SPON1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MST1 (STK4) (NM_006282) Human Over-expression Lysate
LC401893 20 µg

MST1 (STK4) (NM_006282) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGA1 (NM_145904) Human Recombinant Protein
TP317302 20 µg

HMGA1 (NM_145904) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Rat gp130 Protein (Fc Tag)
PDMR100054-01 20 µg

Recombinant Rat gp130 Protein (Fc Tag)

Sign In for Pricing
View Details