Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMD Peptide - C-terminal region

OMD Peptide - C-terminal region

Product Specifications

Product Name Alternative

OSAD, SLRR2C

UniProt

Q99983

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_005005.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S)-beta-Butyrolactone
TRC-B761680-250MG 250 mg

(S)-beta-Butyrolactone

Sign In for Pricing
View Details
HIS Lite™ OG488-Tris NTA-Ni Complex
12615-AAT 100 µg

HIS Lite™ OG488-Tris NTA-Ni Complex

Sign In for Pricing
View Details
Renalase (Renal Cell Marker) (RNLS/1940), CF568 conjugate, 0.1mg/mL
BNC681940-100 1x 100 µL

Renalase (Renal Cell Marker) (RNLS/1940), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(1R, 2S, 5S)-2-Amino Edoxaban
TRC-E480790-10MG 10 mg

(1R, 2S, 5S)-2-Amino Edoxaban

Sign In for Pricing
View Details
Human POTEB activation kit by CRISPRa
GA119411 1 Kit

Human POTEB activation kit by CRISPRa

Sign In for Pricing
View Details
PAG Recombinant Rabbit Monoclonal Antibody [JE41-56]
HA722457 100 µL

PAG Recombinant Rabbit Monoclonal Antibody [JE41-56]

Sign In for Pricing
View Details