Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEC Peptide - N-terminal region

TEC Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSCTK4

UniProt

P42680

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_003206.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRHBP (N-term) Rabbit Polyclonal Antibody
AP51082PU-N 400 µL

CRHBP (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Chlorobutyronitrile
TRC-C365041-50G 50 g

4-Chlorobutyronitrile

Sign In for Pricing
View Details
EFCBP2 (NECAB2) Human Gene Knockout Kit (CRISPR)
KN424047 1 Kit

EFCBP2 (NECAB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CRTAC1 activation kit by CRISPRa
GA110529 1 Kit

Human CRTAC1 activation kit by CRISPRa

Sign In for Pricing
View Details
CD154, AlpHcAbs® Human
HA710332 100 µg

CD154, AlpHcAbs® Human

Sign In for Pricing
View Details
SIGLEC6 (NM_001177547) Human Over-expression Lysate
LC433004 20 µg

SIGLEC6 (NM_001177547) Human Over-expression Lysate

Sign In for Pricing
View Details