Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB6B Peptide - C-terminal region

RAB6B Peptide - C-terminal region

Product Specifications

UniProt

Q9NRW1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057661.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr695 CRISPRa sgRNA lentivector (set of three targets)(Rat)
34605126 3x 1.0µg DNA

Olr695 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Apolipoprotein A4 (APOA4) Antibody
abx432336 200 µL

Apolipoprotein A4 (APOA4) Antibody

Sign In for Pricing
View Details
POLR2G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1683508 1.0 µg DNA

POLR2G sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RPL7 Protein Vector (Mouse) (pPB-N-His)
PV225491 500 ng

RPL7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS600040 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
TRGJ1 sgRNA CRISPR Lentivector (Human) (Target 3)
K2460204 1.0 µg DNA

TRGJ1 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details