What is the catalog number for RAB6B Peptide - C-terminal region?

The catalog number for RAB6B Peptide - C-terminal region is orb2001322.

What sizes are available for RAB6B Peptide - C-terminal region?

RAB6B Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RAB6B Peptide - C-terminal region in stock?

RAB6B Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RAB6B Peptide - C-terminal region

Product Specifications

UniProt

Q9NRW1

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_057661.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ETSAKTGYNVKQLFRRVASALPGMENVQEKSKEGMIDIKLDKPQEPPASE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

21831014 1.0 µg DNA

Gm14124 ORF Vector (Mouse) (pORF)

Sign In for Pricing

View Details

44573091 4x 500 ng

SNORA13-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing

View Details

bsm-61655R-FITC-01 20 µL

USP11 Recombinant Antibody, FITC Conjugated

Sign In for Pricing

View Details

bsm-61655R-FITC-02 100 µL

USP11 Recombinant Antibody, FITC Conjugated

Sign In for Pricing

View Details

sc-421045-NIC 20 µg

IFN-α9 Double Nickase Plasmid (m)

Sign In for Pricing

View Details

MBS8502219-01 0.1 mg

BXDC2 Antibody

Sign In for Pricing

View Details