Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPE4 Peptide - middle region

NXPE4 Peptide - middle region

Product Specifications

Product Name Alternative

FAM55D, C11orf33

UniProt

Q6UWF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001071107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAALTHMYSKNKKVSYLSKQEKSLFERSNVGVEIMEKFNTISVSKCNKET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D13 Antibody
KC-43897-01 50 μL

TBC1D13 Antibody

Sign In for Pricing
View Details
TBC1D13 Antibody
KC-43897-02 100 µL

TBC1D13 Antibody

Sign In for Pricing
View Details
TBC1D13 Antibody
KC-43897-03 1 mL

TBC1D13 Antibody

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human Immunoglobulins
PA-2103-1 1 mL

Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human Immunoglobulins

Sign In for Pricing
View Details
MTMR2 (NM_201281) Human Over-expression Lysate
LC430848 20 µg

MTMR2 (NM_201281) Human Over-expression Lysate

Sign In for Pricing
View Details
HMGCR Antibody
KC-1473-01 50 μL

HMGCR Antibody

Sign In for Pricing
View Details