Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXPE4 Peptide - middle region

NXPE4 Peptide - middle region

Product Specifications

Product Name Alternative

FAM55D, C11orf33

UniProt

Q6UWF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001071107.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CAALTHMYSKNKKVSYLSKQEKSLFERSNVGVEIMEKFNTISVSKCNKET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCP1 (NM_022842) Human Recombinant Protein
TP320633M 100 µg

CDCP1 (NM_022842) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793T-01 25 µg

Elab Fluor® Violet 610 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793T-02 100 µg

Elab Fluor® Violet 610 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Furfural 2,4-Dinitrophenylhydrazone
TRC-F862380-500MG 500 mg

Furfural 2,4-Dinitrophenylhydrazone

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL
BNC740641-100 1x 100 µL

Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RBIS activation kit by CRISPRa
GA118330 1 Kit

Human RBIS activation kit by CRISPRa

Sign In for Pricing
View Details