Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIDT1 Peptide - N-terminal region

SIDT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SID1, SID-1, B830021E24Rik

UniProt

Q9NXL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001295279.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWLLLAASPGHPAKSPRQPPAPRRDPFDAARGADFDHVYSGVVNLSTENI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mfn2 (NM_133201) Mouse Recombinant Protein
TP510494 20 µg

Mfn2 (NM_133201) Mouse Recombinant Protein

Sign In for Pricing
View Details
Cytochrome P450 3A1 / CYP3A1 (P6), 0.2mg/mL
BNUB3058-100 1x 100 µL

Cytochrome P450 3A1 / CYP3A1 (P6), 0.2mg/mL

Sign In for Pricing
View Details
Human Plexin B2 (PLXNB2) activation kit by CRISPRa
GA108463 1 Kit

Human Plexin B2 (PLXNB2) activation kit by CRISPRa

Sign In for Pricing
View Details
Sterol carrier protein 2 (SCP2) (NM_001193600) Human Over-expression Lysate
LY434278 100 µg

Sterol carrier protein 2 (SCP2) (NM_001193600) Human Over-expression Lysate

Sign In for Pricing
View Details
Bis(4-hydroxyphenyl) Sulfone
TRC-B447390-1G 1 g

Bis(4-hydroxyphenyl) Sulfone

Sign In for Pricing
View Details
Human LRRC30 activation kit by CRISPRa
GA117412 1 Kit

Human LRRC30 activation kit by CRISPRa

Sign In for Pricing
View Details