Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIDT1 Peptide - N-terminal region

SIDT1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SID1, SID-1, B830021E24Rik

UniProt

Q9NXL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001295279.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PWLLLAASPGHPAKSPRQPPAPRRDPFDAARGADFDHVYSGVVNLSTENI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H2A.J (H2AFJ) Human Gene Knockout Kit (CRISPR)
KN400117 1 Kit

Histone H2A.J (H2AFJ) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ECE1 Rabbit Polyclonal Antibody
AP17997PU-N 400 µL

ECE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Gabra1 activation kit by CRISPRa
GA201513 1 Kit

Mouse Gabra1 activation kit by CRISPRa

Sign In for Pricing
View Details
Vps52 Mouse Gene Knockout Kit (CRISPR)
KN519265 1 Kit

Vps52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Kallikrein 1 (KLK1) (NM_002257) Human Recombinant Protein
TP720400L 500 µg

Kallikrein 1 (KLK1) (NM_002257) Human Recombinant Protein

Sign In for Pricing
View Details
6-(5-Chloro-2-pyridyl)-6,7-dihydro-7-hydroxy-5H-pyrrolo[3,4-b]pyrazin-5-one
TRC-C379925-1G 1 g

6-(5-Chloro-2-pyridyl)-6,7-dihydro-7-hydroxy-5H-pyrrolo[3,4-b]pyrazin-5-one

Sign In for Pricing
View Details