Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSB2 Peptide - middle region

WSB2 Peptide - middle region

Product Specifications

Product Name Alternative

SBA2

UniProt

Q9NYS7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001265486.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPTX2 Human Pre-designed siRNA Set A
HY-RS09506 1 Set

NPTX2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
LOC688940 3'UTR GFP Stable Cell Line
TU261809 1.0 mL

LOC688940 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Etoricoxib Impurity F
RM-E044306-01 10 mg

Etoricoxib Impurity F

Sign In for Pricing
View Details
Etoricoxib Impurity F
RM-E044306-02 25 mg

Etoricoxib Impurity F

Sign In for Pricing
View Details
Etoricoxib Impurity F
RM-E044306-03 50 mg

Etoricoxib Impurity F

Sign In for Pricing
View Details
Etoricoxib Impurity F
RM-E044306-04 100 mg

Etoricoxib Impurity F

Sign In for Pricing
View Details