Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL9 Peptide - C-terminal region

KLHL9 Peptide - C-terminal region

Product Specifications

UniProt

Q9P2J3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_061335.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESPLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ApoA4 (Apolipoprotein A4) ELISA Kit
E-EL-H0463-01 24 Tests

Human ApoA4 (Apolipoprotein A4) ELISA Kit

Sign In for Pricing
View Details
Human ApoA4 (Apolipoprotein A4) ELISA Kit
E-EL-H0463-02 48 Tests

Human ApoA4 (Apolipoprotein A4) ELISA Kit

Sign In for Pricing
View Details
Human ApoA4 (Apolipoprotein A4) ELISA Kit
E-EL-H0463-03 96 Tests

Human ApoA4 (Apolipoprotein A4) ELISA Kit

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-01 60 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-02 120 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details
GYS2 Polyclonal Antibody
E-AB-90552-03 200 µL

GYS2 Polyclonal Antibody

Sign In for Pricing
View Details