Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCCC1 Peptide - middle region

MCCC1 Peptide - middle region

Product Specifications

Product Name Alternative

MCCA, MCC-B

UniProt

Q96RQ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001280202.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNNVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3- (4-fluorophenyl) propiolate
PC100727-01 100 mg

Ethyl 3- (4-fluorophenyl) propiolate

Sign In for Pricing
View Details
Ethyl 3- (4-fluorophenyl) propiolate
PC100727-02 500 mg

Ethyl 3- (4-fluorophenyl) propiolate

Sign In for Pricing
View Details
Ethyl 3- (4-fluorophenyl) propiolate
PC100727-03 1 g

Ethyl 3- (4-fluorophenyl) propiolate

Sign In for Pricing
View Details
Ethyl 3- (4-fluorophenyl) propiolate
PC100727-04 5 g

Ethyl 3- (4-fluorophenyl) propiolate

Sign In for Pricing
View Details
Ethyl 3- (4-fluorophenyl) propiolate
PC100727-05 10 g

Ethyl 3- (4-fluorophenyl) propiolate

Sign In for Pricing
View Details
Itgb1 Blocking Peptide
33R-7017 0.1 mg

Itgb1 Blocking Peptide

Sign In for Pricing
View Details