Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEM1C Peptide - middle region

FEM1C Peptide - middle region

Product Specifications

Product Name Alternative

FEM1A, EUROIMAGE686608, EUROIMAGE783647

UniProt

Q96JP0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_064562.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RILGPSHPDTSYYIRYRGAVYADSGNFKRCINLWKYALDMQQSNLDPLSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL
BNC470276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL
BNC400352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-500 1x 500 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF594 conjugate, 0.1mg/mL
BNC940750-100 1x 100 µL

CD8 (C8/468 + C8/144B), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (BBM.1), CF568 conjugate, 0.1mg/mL
BNC680142-500 1x 500 µL

Beta-2 Microglobulin (B2M) (BBM.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details