Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5A Peptide - middle region

KIR2DL5A Peptide - middle region

Product Specifications

Product Name Alternative

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

UniProt

Q8N109

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065396.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (FN1/2949), CF740 conjugate, 0.1mg/mL
BNC742949-500 1x 500 µL

Fibronectin (FN1/2949), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL
BNC040696-100 1x 100 µL

Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
METTL4 Rabbit Polyclonal Antibody
TA378483 100 µL

METTL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACTR1A Human Gene Knockout Kit (CRISPR)
KN400738 1 Kit

ACTR1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DPPA2 Rabbit Polyclonal Antibody
TA375602 100 µL

DPPA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(2,4-Dioxo-3,4-dihydropyrimidin-1(2H)-yl)acetic Acid
TRC-D485905-500MG 500 mg

(2,4-Dioxo-3,4-dihydropyrimidin-1(2H)-yl)acetic Acid

Sign In for Pricing
View Details