Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR2DL5A Peptide - middle region

KIR2DL5A Peptide - middle region

Product Specifications

Product Name Alternative

CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3

UniProt

Q8N109

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065396.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MDQEPAGDRTVNREDSDDQDPQEVTYAQLDHCVFTQTKITSPSQRPKTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P73 (Tumor Suppressor) (P73/2531), Biotin conjugate, 0.1mg/mL
BNCB2531-500 1x 500 µL

P73 (Tumor Suppressor) (P73/2531), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL-3RA Rabbit Polyclonal Antibody
HA500291 100 µL

IL-3RA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS806512 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), Biotin conjugate, 0.1mg/mL
BNCB2792-100 1x 100 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2792), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL
BNC473092-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3092), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KAT3A / CBP (CREBBP) Human Gene Knockout Kit (CRISPR)
KN216439RB 1 Kit

KAT3A / CBP (CREBBP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details