Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT3 Peptide - middle region

GNAT3 Peptide - middle region

Product Specifications

Product Name Alternative

GDCA

UniProt

A8MTJ3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001095856.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP1 Polyclonal Antibody
E-AB-70300-01 60 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-70300-02 120 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
CASP1 Polyclonal Antibody
E-AB-70300-03 200 µL

CASP1 Polyclonal Antibody

Sign In for Pricing
View Details
Human KLHL17 activation kit by CRISPRa
GA117425 1 Kit

Human KLHL17 activation kit by CRISPRa

Sign In for Pricing
View Details
ARHGEF14 (MCF2L) Goat Polyclonal Antibody
AP32803PU-N 100 µg

ARHGEF14 (MCF2L) Goat Polyclonal Antibody

Sign In for Pricing
View Details
SAMD12 (NM_001101676) Human Over-expression Lysate
LC420327 20 µg

SAMD12 (NM_001101676) Human Over-expression Lysate

Sign In for Pricing
View Details