Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNAT3 Peptide - middle region

GNAT3 Peptide - middle region

Product Specifications

Product Name Alternative

GDCA

UniProt

A8MTJ3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_001095856.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF740 conjugate, 0.1mg/mL
BNC742123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DNA PKcs (PRKDC) Rabbit Polyclonal Antibody
AP06088PU-N 100 µg

DNA PKcs (PRKDC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL
BNC403124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Rat ACV-A (Activin A) ELISA Kit
E-UNEL-R0082-01 5x 96 Tests

Uncoated Rat ACV-A (Activin A) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat ACV-A (Activin A) ELISA Kit
E-UNEL-R0082-02 15x 96 Tests

Uncoated Rat ACV-A (Activin A) ELISA Kit

Sign In for Pricing
View Details
CSAD (Center) Rabbit Polyclonal Antibody
AP51094PU-N 400 µL

CSAD (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details