What is the catalog number for ZNF81 Peptide - N-terminal region?

The catalog number for ZNF81 Peptide - N-terminal region is orb2001303.

What sizes are available for ZNF81 Peptide - N-terminal region?

ZNF81 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is ZNF81 Peptide - N-terminal region in stock?

ZNF81 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ZNF81 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HFZ20, MRX45, dJ54B20.6

UniProt

P51508

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_009068.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAng-Wyb4341-1mg 1 mg

Recombinant Saccharomyces Cerevisiae BUD23 Protein (aa 1-275) [His]

Sign In for Pricing

View Details

870001 50 mL

Inhibitor B

Sign In for Pricing

View Details

A08899-1 100 µg/Vial

Anti-Secretin/Sct Antibody

Sign In for Pricing

View Details

orb2641556 100 µg

CD5 Antibody

Sign In for Pricing

View Details

orb1328504 100 µg

SUB1 Antibody

Sign In for Pricing

View Details

orb1252415 100 µg

Progesterone Antibody [6-5E-3F]

Sign In for Pricing

View Details