Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF81 Peptide - N-terminal region

ZNF81 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HFZ20, MRX45, dJ54B20.6

UniProt

P51508

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_009068.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep F box only protein 34 (FBXO34) ELISA Kit
GTR10330230 96 Well

Sheep F box only protein 34 (FBXO34) ELISA Kit

Sign In for Pricing
View Details
ZMYM3 Antibody, FITC conjugated
CSB-PA614520LC01HU-01 50 µg

ZMYM3 Antibody, FITC conjugated

Sign In for Pricing
View Details
ZMYM3 Antibody, FITC conjugated
CSB-PA614520LC01HU-02 100 µg

ZMYM3 Antibody, FITC conjugated

Sign In for Pricing
View Details
Map3k12 (NM_013055) Rat Tagged Lenti ORF Clone
RR200674L3 10 µg

Map3k12 (NM_013055) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2111747-01 0.1 mL

Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 12A (IL12A)
MBS2111747-02 0.2 mL

Polyclonal Antibody to Interleukin 12A (IL12A)

Sign In for Pricing
View Details