KMT5A Peptide - middle region
KMT5A Peptide - middle region
Product Specifications
Product Name Alternative
SET8, SET07, SETD8, PR-Set7
UniProt
Q9NQR1
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_065115.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RAAGGKMSKPCAVEAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS289849-01 48 Well
Chicken Pyruvate kinase muscle isozyme ELISA Kit
Sign In for Pricing
View Details MBS289849-02 96 Well
Chicken Pyruvate kinase muscle isozyme ELISA Kit
Sign In for Pricing
View Details MBS289849-03 5x 96 Well
Chicken Pyruvate kinase muscle isozyme ELISA Kit
Sign In for Pricing
View Details MBS289849-04 10x 96 Well
Chicken Pyruvate kinase muscle isozyme ELISA Kit
Sign In for Pricing
View Details 