Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5A Peptide - middle region

KMT5A Peptide - middle region

Product Specifications

Product Name Alternative

SET8, SET07, SETD8, PR-Set7

UniProt

Q9NQR1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_065115.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAAGGKMSKPCAVEAAAAAVAATAPGPEMVERRGPGRPRTDGENVFTGQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nudt8 (NM_025529) Mouse Tagged ORF Clone Lentiviral Particle
MR202277L4V 200 µL

Nudt8 (NM_025529) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Adrenal Lysate
1470 0.1 mg

Adrenal Lysate

Sign In for Pricing
View Details
Exonuclease III
3412 10000 Units - 100 Units/µL

Exonuclease III

Sign In for Pricing
View Details
Mouse Monoclonal Kanadaptin Antibody (2G10)
H00022950-M01 0.1 mg

Mouse Monoclonal Kanadaptin Antibody (2G10)

Sign In for Pricing
View Details
HOXD8
319502 100 µL

HOXD8

Sign In for Pricing
View Details
Rat TNNI2 shRNA Plasmid
abx985467-01 150 µg

Rat TNNI2 shRNA Plasmid

Sign In for Pricing
View Details