Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CP Peptide - middle region

CP Peptide - middle region

Product Specifications

Product Name Alternative

CP-2

UniProt

P00450

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000087.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Protocadherin 15 (PCDH15)
SIPE064Mu02-01 10 µg

Recombinant Protocadherin 15 (PCDH15)

Sign In for Pricing
View Details
Recombinant Protocadherin 15 (PCDH15)
SIPE064Mu02-02 50 µg

Recombinant Protocadherin 15 (PCDH15)

Sign In for Pricing
View Details
Recombinant Protocadherin 15 (PCDH15)
SIPE064Mu02-03 200 µg

Recombinant Protocadherin 15 (PCDH15)

Sign In for Pricing
View Details
Recombinant Protocadherin 15 (PCDH15)
SIPE064Mu02-04 1 mg

Recombinant Protocadherin 15 (PCDH15)

Sign In for Pricing
View Details
Recombinant Protocadherin 15 (PCDH15)
SIPE064Mu02-05 5 mg

Recombinant Protocadherin 15 (PCDH15)

Sign In for Pricing
View Details
CCR11 (ACKR4) (NM_178445) Human Tagged Lenti ORF Clone
RC224197L3 10 µg

CCR11 (ACKR4) (NM_178445) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details