Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CP Peptide - middle region

CP Peptide - middle region

Product Specifications

Product Name Alternative

CP-2

UniProt

P00450

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_000087.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GPA33 (Glycoprotein A33) ELISA Kit
EK250246 96 Well

Human GPA33 (Glycoprotein A33) ELISA Kit

Sign In for Pricing
View Details
SIGLEC5 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1574694 100 µL

SIGLEC5 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
ZNF599 Polyclonal Antibody, RBITC Conjugated
bs-19530R-RBITC 100 µL

ZNF599 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
CBWD1-set siRNA/shRNA/RNAi Lentivector (Human)
15120091 4x 500 ng

CBWD1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
MBS1306182-01 0.02 mg (E-Coli)

Recombinant Shewanella sp. Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)

Sign In for Pricing
View Details
Recombinant Shewanella sp. Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)
MBS1306182-02 0.02 mg (Yeast)

Recombinant Shewanella sp. Phosphoribosylaminoimidazole-succinocarboxamide synthase (purC)

Sign In for Pricing
View Details